Gdsl-like lipase/acylhydrolase family

Author: yzwe

August undefined, 2024

WebIdentifying the lipase activity of the putative GDSL lipase is the prerequisite for dissecting its function. According to the sequence similarity and the conserved domains, we cloned the Brassica napus BnGLIP gene, which encodes a GDSL-like protein. We failed to identify the BnGLIP lipase activity in the bacterium and yeast expression systems. http://pfam-legacy.xfam.org/family/PF00657

Multi-locus genome-wide association study of chickpea reference …

WebFeb 9, 2024 · GDSL esterases/lipases (GELPs), present throughout all living organisms, have been a very attractive research subject in plant science due mainly to constantly … Web>seq_1 MLVNKFKVILLFFIIFTSSYAQNLNTNDTIDSILNQNKNHSALTSYVSKKDLKNLEKKLEKNQNIGIRIYGDSHMAADFFPRVIRGYLIRSNSIGFAYPL ... senior center oakland ca

UniProt

http://pfam-legacy.xfam.org/family/Lipase_GDSL_lke WebJun 1, 2001 · Family and domain databases. CDD. cd01837 SGNH_plant_lipase_like 1 hit; Gene3D. 3.40.50.1110 SGNH hydrolase 1 hit; InterPro. View protein in InterPro; ... PANTHER. PTHR45650:SF67 BNAC03G59270D PROTEIN 1 hit; PTHR45650 GDSL-LIKE LIPASE/ACYLHYDROLASE-RELATED 1 hit; Pfam. View protein in Pfam; PF00657 … WebGDSL-like Lipase/Acylhydrolase family protein, expressed n=2: 7.8e-90: UniRef100_C5WN64: 68.25: 189: Putative uncharacterized protein Sb01g023210 n=1 Tax=Sorghum: 5.4e-84: UniRef100_C5WN69: 76.86: 255: Putative uncharacterized protein Sb01g023244 (Fragment) n=1 : 7.9e-81: UniRef100_Q7G307: 66.67: 294: GDSL-like … senior center nw okc

Isolation and expression analysis of a GDSL-like lipase gene from ...

WebMay 18, 2024 · Those include domains that are likely associated with peptidoglycan lysis such as Melibiase_2 (PF16499; Glycosyl hydrolases family 27) and Glyco_hydro_cc (PF11790; Glycosyl hydrolase catalytic core), but also domains with no obvious role in this process, such as: Methyltransf_16 (PF10294; Lysine methyltransferase), … WebHigh temperature stress leads to complex changes to plant functionality, which affects, i.a., the cell wall structure and the cell wall protein composition. In this study, the qualitative and quantitative changes in the cell wall proteome of Brachypodium distachyon leaves in response to high (40 °C) temperature stress were characterised. Using a proteomic … senior center north las vegasWebApr 5, 2024 · A member of the GDSL lipase family, WDL1, has a substantial role in rice wax and epidermal cell layer biosynthesis . Pepper GDSL lipase performs a significant … senior center of kodiak

"WebJul 22, 2008 · GDSL-like Lipase/Acylhydrolase superfamily protein Imported Gene names ORF names AT1G20132 Imported Ordered locus names At1g20132 Imported Organism … " - Gdsl-like lipase/acylhydrolase family

Gdsl-like lipase/acylhydrolase family

WebFeb 9, 2024 · GDSL esterases/lipases (GELPs), present throughout all living organisms, have been a very attractive research subject in plant science due mainly to constantly emerging properties and functions in plant growth and development under both normal and stressful conditions. This review summarizes the advances in research on plant GELPs … WebProtein Family : GDSL-like lipase/acylhydrolase, putative, expressed 121310086. Method ID: 5274: Method Name: ... GDSL-like lipase/acylhydrolase, putative, expressed: 6: 5274: Embryophyte: Questions? Comments? Click here! Accessibility/Section 508 …

Did you know?

http://aranet.sbs.ntu.edu.sg/responder.py?name=gene!Bdi!8179 WebGDSL-like Lipase/Acylhydrolase family protein [Source:NCBI gene (formerly Entrezgene);Acc:6241329] Location: Chromosome 1: 6984042 - 6985703. Summary: Description: GDSL-like Lipase/Acylhydrolase family protein [Source:NCBI gene (formerly Entrezgene);Acc:6241329] Phenotype: Data Source:

WebPfam includes annotations and additional family information from a range of different sources. These sources can be accessed via the tabs below. No Wikipedia article; Pfam ... GDSL-like Lipase/Acylhydrolase Provide feedback. No Pfam abstract. Internal database links. SCOOP: Lipase_GDSL Lipase_GDSL_2: Similarity to PfamA using HHSearch: WebSep 29, 2024 · CDD Conserved Protein Domain Family: Lipase_GDSL pfam00657 (PSSM ID: 425804): Conserved Protein Domain Family Lipase_GDSL, 3MIL,5W7C,1PP4,5TIC …

http://pfam-legacy.xfam.org/family/Lipase_GDSL_lke WebJul 23, 2024 · Although the terms Lipase-GDSL family and SGNH hydrolase family have been used interchangeably (often written as SGNH/GDSL family), it is now generally understood that the term “SGNH hydrolase” is meant to refer to the superfamily or clan of proteins (Pfam: CL0264) that share this particular overall fold, of which the original GDSL …

WebSep 29, 2024 · pfam13472: Lipase_GDSL_2. Download alignment. GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657. Links.

WebFamily and domain databases. CDD. cd01837 SGNH_plant_lipase_like 1 hit; Gene3D. 3.40.50.1110 SGNH hydrolase 1 hit; InterPro. View protein in InterPro ... PANTHER. PTHR45966:SF1 GDSL ESTERASE/LIPASE 1-RELATED 1 hit; PTHR45966 GDSL-LIKE LIPASE/ACYLHYDROLASE 1 hit; PROSITE. View protein in PROSITE; PS01098 … senior center nrh txWebIn addition, we report the crystal structure of the catalytic domain of XOAT1, which adopts a unique conformation that bears some similarities to the α/β/α topology of members of the GDSL-like lipase/acylhydrolase family. senior center northridge caWebDec 1, 2004 · GDSL-type esterases/lipases (GELPs), a lipid hydrolysis enzyme, typically have a Ser-His-Asp active site near the N-terminus (Upton and Buckley, 1995). Because of the four strictly conserved sites ... senior center of the chathamsWebMar 9, 2024 · GDSL-like Lipase/Acylhydrolase superfamily protein Primary source Araport:AT4G30140 Locus tag AT4G30140 Gene type protein coding RefSeq status REVIEWED Organism Arabidopsis thaliana (ecotype: Columbia) Lineage senior center of yorkWebMar 24, 2024 · We identified, receptor-linked kinases (RLKs) on chromosomes 1, 4 and 6, GDSL-like Lipase/Acylhydrolase on chromosome 3, Aspartic proteinase-like and Thaumatin-like protein on chromosome 4, AT ... senior center of greensboroWebSummary: GDSL-like Lipase/Acylhydrolase Pfam includes annotations and additional family information from a range of different sources. These sources can be accessed via … senior center phenix city alWebAug 22, 2006 · GDSL-like Lipase/Acylhydrolase family protein, expressed. Status. UniProtKB unreviewed (TrEMBL) Organism. Oryza sativa subsp. japonica (Rice) Amino … senior center petersburg wv